EFCAB3 anticorps (N-Term)

N° du produit ABIN633117

Cet anticorps anti-EFCAB3 est un anticorps Lapin Polyclonal détectant EFCAB3 dans WB. Adapté pour Humain.

Aperçu rapide pour EFCAB3 anticorps (N-Term) (ABIN633117)

Antigène: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EFCAB3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EFCAB3 anticorps

Épitope: N-Term

Specificité: EFCAB3 antibody was raised against the N terminal of EFCAB3

Purification: Affinity purified

Immunogène: EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFCAB3 Blocking Peptide, (ABIN5613310), is also available for use as a blocking control in assays to test for specificity of this EFCAB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFCAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EFCAB3

Antigène: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Autre désignation: EFCAB3

Sujet: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 50 kDa (MW of target protein)