TMEM139 anticorps (N-Term)

N° du produit ABIN633124

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM139 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TMEM139 anticorps (N-Term) (ABIN633124)

Antigène: TMEM139 (Transmembrane Protein 139 (TMEM139))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM139 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM139 anticorps

Épitope: N-Term

Specificité: TMEM139 antibody was raised against the N terminal of TMEM139

Purification: Affinity purified

Immunogène: TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM139 Blocking Peptide, (ABIN939572), is also available for use as a blocking control in assays to test for specificity of this TMEM139 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM139 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM139

Antigène: TMEM139 (Transmembrane Protein 139 (TMEM139))

Autre désignation: TMEM139

Sujet: The function of TMEM139 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 24 kDa (MW of target protein)