FAM118A anticorps (Middle Region)

N° du produit ABIN633127

Cet anticorps Lapin Polyclonal détecte spécifiquement FAM118A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FAM118A anticorps (Middle Region) (ABIN633127)

Antigène: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM118A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM118A anticorps

Épitope: Middle Region

Specificité: FAM118 A antibody was raised against the middle region of FAM118

Purification: Affinity purified

Immunogène: FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM118A Blocking Peptide, (ABIN938188), is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM118A

Antigène: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Autre désignation: FAM118A

Sujet: The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 40 kDa (MW of target protein)