MAGEA5 anticorps (N-Term)

N° du produit ABIN633132

Détail du produit anti-MAGEA5 anticorps

Antigène: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEA5 antibody was raised against the N terminal of MAGEA5

Purification: Affinity purified

Immunogène: MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA5 Blocking Peptide, catalog no. 33R-6458, is also available for use as a blocking control in assays to test for specificity of this MAGEA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA5

Antigène: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Autre désignation: MAGEA5 (MAGEA5 Produits)

Synonymes: anticorps CT1.5, anticorps MAGE5, anticorps MAGEA4, anticorps Mage-a5, anticorps MAGE family member A5, anticorps melanoma antigen, family A, 5, anticorps MAGEA5, anticorps Magea5

Sujet: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.

Poids moléculaire: 13 kDa (MW of target protein)