MEIOB anticorps (Middle Region)

N° du produit ABIN633134

L’anticorps Lapin Polyclonal anti-MEIOB a été validé pour WB. Il convient pour détecter MEIOB dans des échantillons de Humain.

Aperçu rapide pour MEIOB anticorps (Middle Region) (ABIN633134)

Antigène: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MEIOB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MEIOB anticorps

Épitope: Middle Region

Specificité: C16 orf73 antibody was raised against the middle region of C16 rf73

Purification: Affinity purified

Immunogène: C16 orf73 antibody was raised using the middle region of C16 rf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16orf73 Blocking Peptide, (ABIN937197), is also available for use as a blocking control in assays to test for specificity of this C16orf73 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf73 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MEIOB

Antigène: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Autre désignation: C16orf73

Sujet: C16orf73 may be involved in early meiosis.

Poids moléculaire: 22 kDa (MW of target protein)