C8orf45 anticorps (Middle Region)

N° du produit ABIN633137

L’anticorps anti-C8orf45 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de C8orf45 dans des échantillons provenant de Humain. }

Aperçu rapide pour C8orf45 anticorps (Middle Region) (ABIN633137)

Antigène: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C8orf45 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C8orf45 anticorps

Épitope: Middle Region

Specificité: C8 orf45 antibody was raised against the middle region of C8 rf45

Purification: Affinity purified

Immunogène: C8 orf45 antibody was raised using the middle region of C8 rf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C8orf45 Blocking Peptide, (ABIN939493), is also available for use as a blocking control in assays to test for specificity of this C8orf45 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C8orf45

Antigène: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Autre désignation: C8orf45

Sujet: The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 65 kDa (MW of target protein)