NT5DC2 anticorps (N-Term)

N° du produit ABIN633138

Cet anticorps anti-NT5DC2 est un anticorps Lapin Polyclonal détectant NT5DC2 dans WB. Adapté pour Humain.

Aperçu rapide pour NT5DC2 anticorps (N-Term) (ABIN633138)

Antigène: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5DC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NT5DC2 anticorps

Épitope: N-Term

Specificité: NT5 DC2 antibody was raised against the N terminal of NT5 C2

Purification: Affinity purified

Immunogène: NT5 DC2 antibody was raised using the N terminal of NT5 C2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5DC2 Blocking Peptide, (ABIN939521), is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5DC2

Antigène: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Autre désignation: NT5DC2

Sujet: The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

Poids moléculaire: 61 kDa (MW of target protein)