NT5DC2 anticorps (N-Term)

N° du produit ABIN633138

Détail du produit anti-NT5DC2 anticorps

Antigène: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5DC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NT5 DC2 antibody was raised against the N terminal of NT5 C2

Purification: Affinity purified

Immunogène: NT5 DC2 antibody was raised using the N terminal of NT5 C2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5DC2 Blocking Peptide, catalog no. 33R-4135, is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5DC2

Antigène: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Autre désignation: NT5DC2 (NT5DC2 Produits)

Synonymes: anticorps 2510015F01Rik, anticorps RGD1305524, anticorps MGC83840, anticorps im:6907673, anticorps wu:fb83e03, anticorps wu:fe11h11, anticorps zgc:153357, anticorps 5'-nucleotidase domain containing 2, anticorps 5'-nucleotidase domain containing 2 b, anticorps NT5DC2, anticorps Nt5dc2, anticorps nt5dc2.S, anticorps nt5dc2, anticorps nt5dc2-b

Sujet: The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

Poids moléculaire: 61 kDa (MW of target protein)