SH3KBP1 anticorps (N-Term)

N° du produit ABIN633146

Détail du produit anti-SH3KBP1 anticorps

Antigène: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3KBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 KBP1 antibody was raised against the N terminal of SH3 BP1

Purification: Affinity purified

Immunogène: SH3 KBP1 antibody was raised using the N terminal of SH3 BP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3KBP1 Blocking Peptide, catalog no. 33R-9090, is also available for use as a blocking control in assays to test for specificity of this SH3KBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 BP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3KBP1

Antigène: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Autre désignation: SH3KBP1 (SH3KBP1 Produits)

Synonymes: anticorps CD2BP3, anticorps CIN85, anticorps GIG10, anticorps HSB-1, anticorps HSB1, anticorps MIG18, anticorps 1200007H22Rik, anticorps 1700125L08Rik, anticorps 5830464D22Rik, anticorps AI447724, anticorps IN85, anticorps Ruk, anticorps Seta, anticorps SH3 domain containing kinase binding protein 1, anticorps SH3-domain kinase binding protein 1, anticorps SH3 domain-containing kinase-binding protein 1, anticorps SH3KBP1, anticorps sh3kbp1, anticorps LOC100551401, anticorps Sh3kbp1

Sujet: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, EGFR Downregulation