NRBF2 anticorps (N-Term)

N° du produit ABIN633155

Détail du produit anti-NRBF2 anticorps

Antigène: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NRBF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NRBF2 antibody was raised against the N terminal of NRBF2

Purification: Affinity purified

Immunogène: NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRBF2 Blocking Peptide, catalog no. 33R-4448, is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NRBF2

Antigène: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Autre désignation: NRBF2 (NRBF2 Produits)

Synonymes: anticorps COPR1, anticorps COPR2, anticorps NRBF-2, anticorps nuclear receptor binding factor 2, anticorps NRBF2, anticorps Nrbf2

Sujet: NRBF2 may modulate transcriptional activation by target nuclear receptors.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway