NRBF2 anticorps (N-Term)
-
- Antigène Voir toutes NRBF2 Anticorps
- NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NRBF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NRBF2 antibody was raised against the N terminal of NRBF2
- Purification
- Affinity purified
- Immunogène
- NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL
- Top Product
- Discover our top product NRBF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NRBF2 Blocking Peptide, catalog no. 33R-4448, is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))
- Autre désignation
- NRBF2 (NRBF2 Produits)
- Synonymes
- anticorps COPR1, anticorps COPR2, anticorps NRBF-2, anticorps nuclear receptor binding factor 2, anticorps NRBF2, anticorps Nrbf2
- Sujet
- NRBF2 may modulate transcriptional activation by target nuclear receptors.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway
-