CRNN anticorps (Middle Region)

N° du produit ABIN633156

Détail du produit anti-CRNN anticorps

Antigène: CRNN (Cornulin (CRNN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRNN est non-conjugé

Application: Western Blotting (WB)

Specificité: Cornulin antibody was raised against the middle region of CRNN

Purification: Affinity purified

Immunogène: Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRNN

Antigène: CRNN (Cornulin (CRNN))

Autre désignation: Cornulin (CRNN Produits)

Synonymes: anticorps C1orf10, anticorps DRC1, anticorps PDRC1, anticorps SEP53, anticorps RGD1311778, anticorps Gm1015, anticorps cornulin, anticorps CRNN, anticorps Crnn, anticorps LOC100359146

Sujet: This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.

Poids moléculaire: 52 kDa (MW of target protein)