PAGE4 anticorps

N° du produit ABIN633161

Détail du produit anti-PAGE4 anticorps

Antigène: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAGE4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAGE4

Antigène: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Autre désignation: PAGE4 (PAGE4 Produits)

Synonymes: anticorps CT16.7, anticorps GAGE-9, anticorps GAGEC1, anticorps JM-27, anticorps PAGE-1, anticorps PAGE-4, anticorps PAGE family member 4, anticorps PAGE4

Sujet: This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Poids moléculaire: 11 kDa (MW of target protein)