MMP19 anticorps (N-Term)

N° du produit ABIN633173

Détail du produit anti-MMP19 anticorps

Antigène: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP19 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MMP19 antibody was raised against the N terminal of MMP19

Purification: Affinity purified

Immunogène: MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP19 Blocking Peptide, catalog no. 33R-1365, is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP19

Antigène: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Autre désignation: MMP19 (MMP19 Produits)

Synonymes: anticorps mmp18, anticorps mmp-18, anticorps mmp-19, anticorps col4, anticorps MMP18, anticorps RASI-1, anticorps matrix metallopeptidase 19, anticorps matrix metallopeptidase 1 S homeolog, anticorps mmp19, anticorps mmp1.S, anticorps MMP19, anticorps Mmp19

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.

Poids moléculaire: 56 kDa (MW of target protein)