PLXDC1 anticorps (N-Term)

N° du produit ABIN633181

Cet anticorps Lapin Polyclonal détecte spécifiquement PLXDC1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PLXDC1 anticorps (N-Term) (ABIN633181)

Antigène: PLXDC1 (Plexin Domain Containing 1 (PLXDC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLXDC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLXDC1 anticorps

Épitope: N-Term

Specificité: PLXDC1 antibody was raised against the N terminal of PLXDC1

Purification: Affinity purified

Immunogène: PLXDC1 antibody was raised using the N terminal of PLXDC1 corresponding to a region with amino acids MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLXDC1 Blocking Peptide, (ABIN5615428), is also available for use as a blocking control in assays to test for specificity of this PLXDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLXDC1

Antigène: PLXDC1 (Plexin Domain Containing 1 (PLXDC1))

Autre désignation: PLXDC1

Sujet: PLXDC1 (TEM7) may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy. The expression level of TEM7 closely parallels histology-based prognostication of osteogenic sarcoma metastasis and, therefore, it is a therapeutic target.

Poids moléculaire: 54 kDa (MW of target protein)