RECQL5 anticorps (Middle Region)

N° du produit ABIN633185

L’anticorps anti-RECQL5 Polyclonal Lapin est utilisé pour la détection de RECQL5 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour RECQL5 anticorps (Middle Region) (ABIN633185)

Antigène: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RECQL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RECQL5 anticorps

Épitope: Middle Region

Specificité: RecQL5 antibody was raised against the middle region of RECQL5

Purification: Affinity purified

Immunogène: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RecQL5 Blocking Peptide, (ABIN937047), is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RECQL5

Antigène: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Autre désignation: RecQL5

Sujet: RECQL5 may have an important role in DNA metabolism.

Poids moléculaire: 109 kDa (MW of target protein)