RECQL5 anticorps (Middle Region)

N° du produit ABIN633185

Détail du produit anti-RECQL5 anticorps

Antigène: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RECQL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: RecQL5 antibody was raised against the middle region of RECQL5

Purification: Affinity purified

Immunogène: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RECQL5

Antigène: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Autre désignation: RecQL5 (RECQL5 Produits)

Synonymes: anticorps RecQ5, anticorps DKFZp459N0627, anticorps recq5, anticorps RECQ5, anticorps Recq5b, anticorps Recql5b, anticorps RecQ like helicase 5, anticorps RecQ helicase-like 5, anticorps ATP-dependent DNA helicase Q5, anticorps RecQ protein-like 5, anticorps RECQL5, anticorps recql5, anticorps LOC100544199, anticorps Recql5

Sujet: RECQL5 may have an important role in DNA metabolism.

Poids moléculaire: 109 kDa (MW of target protein)