NBEAL1 anticorps (N-Term)

N° du produit ABIN633188

Détail du produit anti-NBEAL1 anticorps

Antigène: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NBEAL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NBEAL1 antibody was raised against the N terminal of NBEAL1

Purification: Affinity purified

Immunogène: NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NBEAL1 Blocking Peptide, catalog no. 33R-4298, is also available for use as a blocking control in assays to test for specificity of this NBEAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NBEAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NBEAL1

Antigène: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Autre désignation: NBEAL1 (NBEAL1 Produits)

Synonymes: anticorps A530083I02Rik, anticorps ALS2CR16, anticorps ALS2CR17, anticorps neurobeachin like 1, anticorps NBEAL1

Sujet: NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.

Poids moléculaire: 153 kDa (MW of target protein)