CPSF4 anticorps (C-Term)

N° du produit ABIN633192

Cet anticorps anti-CPSF4 est un anticorps Lapin Polyclonal détectant CPSF4 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour CPSF4 anticorps (C-Term) (ABIN633192)

Antigène: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPSF4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CPSF4 anticorps

Épitope: C-Term

Specificité: CPSF4 antibody was raised against the C terminal of CPSF4

Purification: Affinity purified

Immunogène: CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPSF4 Blocking Peptide, (ABIN5612987), is also available for use as a blocking control in assays to test for specificity of this CPSF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPSF4

Antigène: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Autre désignation: CPSF4

Sujet: Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

Poids moléculaire: 24 kDa (MW of target protein)