TDRD9 anticorps (Middle Region)

N° du produit ABIN633194

Détail du produit anti-TDRD9 anticorps

Antigène: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TDRD9 est non-conjugé

Application: Western Blotting (WB)

Specificité: TDRD9 antibody was raised against the middle region of TDRD9

Purification: Affinity purified

Immunogène: TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TDRD9 Blocking Peptide, catalog no. 33R-1276, is also available for use as a blocking control in assays to test for specificity of this TDRD9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDRD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TDRD9

Antigène: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Autre désignation: TDRD9 (TDRD9 Produits)

Synonymes: anticorps MGC146806, anticorps C14orf75, anticorps HIG-1, anticorps NET54, anticorps 4930441E05Rik, anticorps si:dkey-15f17.9, anticorps tdrd9l, anticorps tudor domain containing 9, anticorps TDRD9, anticorps tdrd9, anticorps Tdrd9

Sujet: TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Poids moléculaire: 103 kDa (MW of target protein)