RPL5 anticorps (N-Term)

N° du produit ABIN633202

Cet anticorps Lapin Polyclonal détecte spécifiquement RPL5 dans WB. Il présente une réactivité envers Humain, Souris, Rat, Drosophila melanogaster et Arabidopsis.

Aperçu rapide pour RPL5 anticorps (N-Term) (ABIN633202)

Antigène: RPL5 (Ribosomal Protein L5 (RPL5))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPL5 anticorps

Épitope: N-Term

Specificité: RPL5 antibody was raised against the N terminal of RPL5

Purification: Affinity purified

Immunogène: RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL5 Blocking Peptide, (ABIN5615941), is also available for use as a blocking control in assays to test for specificity of this RPL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL5

Antigène: RPL5 (Ribosomal Protein L5 (RPL5))

Autre désignation: RPL5

Sujet: RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Poids moléculaire: 34 kDa (MW of target protein)