DAZ1 anticorps (N-Term)

N° du produit ABIN633207

Détail du produit anti-DAZ1 anticorps

Antigène: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAZ1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DAZ1 antibody was raised against the N terminal of DAZ1

Purification: Affinity purified

Immunogène: DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAZ1 Blocking Peptide, catalog no. 33R-6391, is also available for use as a blocking control in assays to test for specificity of this DAZ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAZ1

Antigène: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Autre désignation: DAZ1 (DAZ1 Produits)

Synonymes: anticorps DAZ1, anticorps DAZ4, anticorps DAZ, anticorps SPGY, anticorps deleted in azoospermia protein 1, anticorps deleted in azoospermia 1, anticorps LOC749905, anticorps DAZ1

Sujet: DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.

Poids moléculaire: 64 kDa (MW of target protein)