Snurportin 1 anticorps (Middle Region)

N° du produit ABIN633209

L’anticorps anti-Snurportin 1 Polyclonal Lapin est utilisé pour la détection de Snurportin 1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Snurportin 1 anticorps (Middle Region) (ABIN633209)

Antigène: Snurportin 1 (SNUPN)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Snurportin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Snurportin 1 anticorps

Épitope: Middle Region

Specificité: SNUPN antibody was raised against the middle region of SNUPN

Purification: Affinity purified

Immunogène: SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNUPN Blocking Peptide, (ABIN939014), is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNUPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Snurportin 1

Antigène: Snurportin 1 (SNUPN)

Autre désignation: SNUPN

Sujet: The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Protein targeting to Nucleus