RAVER2 anticorps (Middle Region)

N° du produit ABIN633210

Détail du produit anti-RAVER2 anticorps

Antigène: RAVER2 (Ribonucleoprotein, PTB-Binding 2 (RAVER2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAVER2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RAVER2 antibody was raised against the middle region of RAVER2

Purification: Affinity purified

Immunogène: RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAVER2 Blocking Peptide, catalog no. 33R-9130, is also available for use as a blocking control in assays to test for specificity of this RAVER2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAVER2

Antigène: RAVER2 (Ribonucleoprotein, PTB-Binding 2 (RAVER2))

Autre désignation: RAVER2 (RAVER2 Produits)

Synonymes: anticorps A430091O22Rik, anticorps ribonucleoprotein, PTB binding 2, anticorps ribonucleoprotein, PTB-binding 2, anticorps RAVER2, anticorps Raver2

Sujet: RAVER2 may bind single stranded nucleic acids.

Poids moléculaire: 73 kDa (MW of target protein)