NXF1 anticorps (N-Term)

N° du produit ABIN633230

L’anticorps Lapin Polyclonal anti-NXF1 a été validé pour WB. Il convient pour détecter NXF1 dans des échantillons de Humain et Chien.

Aperçu rapide pour NXF1 anticorps (N-Term) (ABIN633230)

Antigène: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NXF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NXF1 anticorps

Épitope: N-Term

Specificité: NXF1 antibody was raised against the N terminal of NXF1

Purification: Affinity purified

Immunogène: NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NXF1 Blocking Peptide, (ABIN5615091), is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NXF1

Antigène: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Autre désignation: NXF1

Sujet: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Poids moléculaire: 68 kDa (MW of target protein)