HNRNPA2B1 anticorps (N-Term)

N° du produit ABIN633233

L’anticorps Lapin Polyclonal anti-HNRNPA2B1 a été validé pour WB. Il convient pour détecter HNRNPA2B1 dans des échantillons de Humain et Rat.

Aperçu rapide pour HNRNPA2B1 anticorps (N-Term) (ABIN633233)

Antigène: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA2B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNRNPA2B1 anticorps

Épitope: N-Term

Specificité: HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1

Purification: Affinity purified

Immunogène: HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRNPA2B1 Blocking Peptide, (ABIN5614039), is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPA2B1

Antigène: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Autre désignation: HNRNPA2B1

Sujet: HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 37 kDa (MW of target protein)