SNRPD2 anticorps (N-Term)

N° du produit ABIN633239

L’anticorps anti-SNRPD2 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de SNRPD2 dans des échantillons provenant de Humain, Souris et Rat. }

Aperçu rapide pour SNRPD2 anticorps (N-Term) (ABIN633239)

Antigène: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SNRPD2 anticorps

Épitope: N-Term

Specificité: SNRPD2 antibody was raised against the N terminal of SNRPD2

Purification: Affinity purified

Immunogène: SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPD2 Blocking Peptide, (ABIN5616327), is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPD2

Antigène: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Autre désignation: SNRPD2

Sujet: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization