SNRPD2 anticorps (N-Term)

N° du produit ABIN633239

Détail du produit anti-SNRPD2 anticorps

Antigène: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SNRPD2 antibody was raised against the N terminal of SNRPD2

Purification: Affinity purified

Immunogène: SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPD2 Blocking Peptide, catalog no. 33R-6463, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPD2

Antigène: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Autre désignation: SNRPD2 (SNRPD2 Produits)

Synonymes: anticorps SMD2, anticorps SNRPD1, anticorps Sm-D2, anticorps sm-d2, anticorps smd2, anticorps snrpd1, anticorps 170.t00019, anticorps NCU03778.1, anticorps 1810009A06Rik, anticorps im:6908977, anticorps si:dkey-113g17.2, anticorps zgc:110732, anticorps small nuclear ribonucleoprotein D2 polypeptide, anticorps small nuclear ribonucleoprotein D2 polypeptide L homeolog, anticorps small nuclear ribonucleoprotein Sm D2, anticorps small nuclear ribonucleoprotein sm D2, anticorps small nuclear ribonucleoprotein sm d2, anticorps small nuclear ribonucleoprotein D2, anticorps SNRPD2, anticorps snrpd2, anticorps snrpd2.L, anticorps EHI_108640, anticorps NCU03778, anticorps PVX_002615, anticorps SMP4, anticorps EDI_187160, anticorps LOC100036587, anticorps Snrpd2

Sujet: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization