RBM39 anticorps (Middle Region)
-
- Antigène Voir toutes RBM39 Anticorps
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBM39 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM39 antibody was raised against the middle region of RBM39
- Purification
- Affinity purified
- Immunogène
- RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
- Top Product
- Discover our top product RBM39 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM39 Blocking Peptide, catalog no. 33R-3048, is also available for use as a blocking control in assays to test for specificity of this RBM39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
- Autre désignation
- RBM39 (RBM39 Produits)
- Synonymes
- anticorps CAPER, anticorps CAPERalpha, anticorps FSAP59, anticorps HCC1, anticorps RNPC2, anticorps 1500012C14Rik, anticorps 2310040E03Rik, anticorps B330012G18Rik, anticorps C79248, anticorps R75070, anticorps Rnpc2, anticorps caper, anticorps RBM39, anticorps Rbm39, anticorps ACYPI002389, anticorps DKFZp459F148, anticorps rnpc2, anticorps zgc:55780, anticorps rnpc2l, anticorps wu:fa97g07, anticorps wu:fb09c08, anticorps zgc:112139, anticorps zgc:113117, anticorps RNA binding motif protein 39, anticorps RNA binding motif protein 39a, anticorps RNA binding motif protein 39 L homeolog, anticorps RNA binding motif protein 39b, anticorps RBM39, anticorps Rbm39, anticorps rbm39a, anticorps rbm39.L, anticorps rbm39b
- Sujet
- RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
- Poids moléculaire
- 20 kDa (MW of target protein)
-