SMN1 anticorps (N-Term)

N° du produit ABIN633245

L’anticorps Lapin Polyclonal anti-SMN1 a été validé pour WB. Il convient pour détecter SMN1 dans des échantillons de Humain et Chien.

Aperçu rapide pour SMN1 anticorps (N-Term) (ABIN633245)

Antigène: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMN1 anticorps

Épitope: N-Term

Specificité: SMN1 antibody was raised against the N terminal of SMN1

Purification: Affinity purified

Immunogène: SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMN1 Blocking Peptide, (ABIN939647), is also available for use as a blocking control in assays to test for specificity of this SMN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMN1

Antigène: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Autre désignation: SMN1

Sujet: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization