DIS3 anticorps

N° du produit ABIN633251

L’anticorps Lapin Polyclonal anti-DIS3 a été validé pour WB. Il convient pour détecter DIS3 dans des échantillons de Humain.

Aperçu rapide pour DIS3 anticorps (ABIN633251)

Antigène: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DIS3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DIS3 anticorps

Purification: Affinity purified

Immunogène: DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DIS3 Blocking Peptide, (ABIN937396), is also available for use as a blocking control in assays to test for specificity of this DIS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DIS3

Antigène: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Autre désignation: DIS3

Sujet: DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Poids moléculaire: 109 kDa (MW of target protein)