RDBP anticorps (N-Term)

N° du produit ABIN633256

Détail du produit anti-RDBP anticorps

Antigène: RDBP (RD RNA Binding Protein (RDBP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDBP est non-conjugé

Application: Western Blotting (WB)

Specificité: RDBP antibody was raised against the N terminal of RDBP

Purification: Affinity purified

Immunogène: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDBP Blocking Peptide, catalog no. 33R-5514, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDBP

Antigène: RDBP (RD RNA Binding Protein (RDBP))

Autre désignation: RDBP (RDBP Produits)

Sujet: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).

Poids moléculaire: 43 kDa (MW of target protein)