DHX15 anticorps

N° du produit ABIN633263

L’anticorps Lapin Polyclonal anti-DHX15 a été validé pour WB. Il convient pour détecter DHX15 dans des échantillons de Humain, Souris, Rat et Arabidopsis.

Aperçu rapide pour DHX15 anticorps (ABIN633263)

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivité: Humain, Souris, Rat, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHX15 anticorps

Purification: Affinity purified

Immunogène: DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX15 Blocking Peptide, (ABIN936106), is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX15

Antigène: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Autre désignation: DHX15

Sujet: DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Poids moléculaire: 91 kDa (MW of target protein)