KRR1 anticorps (C-Term)

N° du produit ABIN633275

L’anticorps Lapin Polyclonal anti-KRR1 a été validé pour WB. Il convient pour détecter KRR1 dans des échantillons de Humain.

Aperçu rapide pour KRR1 anticorps (C-Term) (ABIN633275)

Antigène: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KRR1 anticorps

Épitope: C-Term

Specificité: KRR1 antibody was raised against the C terminal of KRR1

Purification: Affinity purified

Immunogène: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KRR1 Blocking Peptide, (ABIN939639), is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRR1

Antigène: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Autre désignation: KRR1

Sujet: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Poids moléculaire: 44 kDa (MW of target protein)