Pre-mRNA Branch Site Protein p14 (SF3B14) (N-Term) anticorps

N° du produit ABIN633279

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour Pre-mRNA Branch Site Protein p14 (SF3B14) (N-Term) anticorps (ABIN633279)

Antigène: Pre-mRNA Branch Site Protein p14 (SF3B14)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: SF3 B14 antibody was raised against the N terminal of SF3 14

Purification: Affinity purified

Immunogène: SF3 B14 antibody was raised using the N terminal of SF3 14 corresponding to a region with amino acids MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B14 Blocking Peptide, (ABIN5616089), is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Pre-mRNA Branch Site Protein p14 (SF3B14)

Autre désignation: SF3B14

Sujet: SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Poids moléculaire: 14 kDa (MW of target protein)