RPL3 anticorps (C-Term)

N° du produit ABIN633286

Détail du produit anti-RPL3 anticorps

Antigène: RPL3 (Ribosomal Protein L3 (RPL3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL3 antibody was raised against the C terminal of RPL3

Purification: Affinity purified

Immunogène: RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL3

Antigène: RPL3 (Ribosomal Protein L3 (RPL3))

Autre désignation: RPL3 (RPL3 Produits)

Synonymes: anticorps ASC-1, anticorps L3, anticorps TARBP-B, anticorps F2, anticorps J1, anticorps wu:fa99g02, anticorps wu:fb65e09, anticorps zgc:110350, anticorps CG4863, anticorps Dmel\\CG4863, anticorps Rpl3, anticorps anon-EST:GressD4, anticorps rpL3, anticorps ribosomal protein L3, anticorps 60S ribosomal protein L3, anticorps ribosomal protein L3 L homeolog, anticorps 50S ribosomal protein L3, anticorps Ribosomal protein L3, anticorps RPL3, anticorps Rpl3, anticorps rpl-3, anticorps rpl3, anticorps rpl3.L, anticorps RpL3

Sujet: Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.

Poids moléculaire: 40 kDa (MW of target protein)