RPL3 anticorps (C-Term)
-
- Antigène Voir toutes RPL3 Anticorps
- RPL3 (Ribosomal Protein L3 (RPL3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPL3 antibody was raised against the C terminal of RPL3
- Purification
- Affinity purified
- Immunogène
- RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
- Top Product
- Discover our top product RPL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPL3 (Ribosomal Protein L3 (RPL3))
- Autre désignation
- RPL3 (RPL3 Produits)
- Synonymes
- anticorps ASC-1, anticorps L3, anticorps TARBP-B, anticorps F2, anticorps J1, anticorps wu:fa99g02, anticorps wu:fb65e09, anticorps zgc:110350, anticorps CG4863, anticorps Dmel\\CG4863, anticorps Rpl3, anticorps anon-EST:GressD4, anticorps rpL3, anticorps ribosomal protein L3, anticorps 60S ribosomal protein L3, anticorps ribosomal protein L3 L homeolog, anticorps 50S ribosomal protein L3, anticorps Ribosomal protein L3, anticorps RPL3, anticorps Rpl3, anticorps rpl-3, anticorps rpl3, anticorps rpl3.L, anticorps RpL3
- Sujet
- Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.
- Poids moléculaire
- 40 kDa (MW of target protein)
-