SNRPA1 anticorps (N-Term)

N° du produit ABIN633289

Cet anticorps Lapin Polyclonal détecte spécifiquement SNRPA1 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour SNRPA1 anticorps (N-Term) (ABIN633289)

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SNRPA1 anticorps

Épitope: N-Term

Specificité: SNRPA1 antibody was raised against the N terminal of SNRPA1

Purification: Affinity purified

Immunogène: SNRPA1 antibody was raised using the N terminal of SNRPA1 corresponding to a region with amino acids VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPA1 Blocking Peptide, (ABIN5616324), is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPA1

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Autre désignation: SNRPA1

Sujet: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Poids moléculaire: 28 kDa (MW of target protein)