SRSF3 anticorps (N-Term)

N° du produit ABIN633291

Cet anticorps anti-SRSF3 est un anticorps Lapin Polyclonal détectant SRSF3 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SRSF3 anticorps (N-Term) (ABIN633291)

Antigène: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRSF3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SRSF3 anticorps

Épitope: N-Term

Specificité: SFRS3 antibody was raised against the N terminal of SFRS3

Purification: Affinity purified

Immunogène: SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS3 Blocking Peptide, (ABIN5616101), is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRSF3

Antigène: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Autre désignation: SFRS3

Sujet: SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.

Poids moléculaire: 19 kDa (MW of target protein)