CELF6 anticorps

N° du produit ABIN633299

Détail du produit anti-CELF6 anticorps

Antigène: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: BRUNOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRUNOL6 Blocking Peptide, catalog no. 33R-7452, is also available for use as a blocking control in assays to test for specificity of this BRUNOL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF6

Antigène: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Autre désignation: BRUNOL6 (CELF6 Produits)

Synonymes: anticorps BRUNOL6, anticorps 6330569O16Rik, anticorps Brunol6, anticorps CUGBP Elav-like family member 6, anticorps CUGBP, Elav-like family member 6, anticorps CELF6, anticorps Celf6

Sujet: BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.

Poids moléculaire: 50 kDa (MW of target protein)