RBM45 anticorps (Middle Region)

N° du produit ABIN633300

Cet anticorps anti-RBM45 est un anticorps Lapin Polyclonal détectant RBM45 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour RBM45 anticorps (Middle Region) (ABIN633300)

Antigène: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM45 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM45 anticorps

Épitope: Middle Region

Specificité: RBM45 antibody was raised against the middle region of RBM45

Purification: Affinity purified

Immunogène: RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM45 Blocking Peptide, (ABIN5615795), is also available for use as a blocking control in assays to test for specificity of this RBM45 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM45

Antigène: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Autre désignation: RBM45

Sujet: RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.

Poids moléculaire: 53 kDa (MW of target protein)