RBM45 anticorps (Middle Region)

N° du produit ABIN633300

Détail du produit anti-RBM45 anticorps

Antigène: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM45 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM45 antibody was raised against the middle region of RBM45

Purification: Affinity purified

Immunogène: RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM45 Blocking Peptide, catalog no. 33R-6375, is also available for use as a blocking control in assays to test for specificity of this RBM45 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM45

Antigène: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Autre désignation: RBM45 (RBM45 Produits)

Synonymes: anticorps DRB1, anticorps Drb1, anticorps Drbp1, anticorps G430095G15Rik, anticorps drb1, anticorps drbp1, anticorps MGC53228, anticorps RBM45, anticorps si:ch211-222f23.2, anticorps DKFZp459H0661, anticorps RNA binding motif protein 45, anticorps RNA binding motif protein 45 S homeolog, anticorps RBM45, anticorps Rbm45, anticorps rbm45.S, anticorps rbm45

Sujet: RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.

Poids moléculaire: 53 kDa (MW of target protein)