DND1 anticorps

N° du produit ABIN633302

L’anticorps anti-DND1 Polyclonal Lapin est utilisé pour la détection de DND1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour DND1 anticorps (ABIN633302)

Antigène: DND1 (Dead End Homolog 1 (DND1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DND1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DND1 anticorps

Purification: Affinity purified

Immunogène: DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DND1 Blocking Peptide, (ABIN939226), is also available for use as a blocking control in assays to test for specificity of this DND1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DND1

Antigène: DND1 (Dead End Homolog 1 (DND1))

Autre désignation: DND1

Sujet: DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.

Poids moléculaire: 39 kDa (MW of target protein)