DGCR8 anticorps (N-Term)

N° du produit ABIN633303

Détail du produit anti-DGCR8 anticorps

Antigène: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGCR8 est non-conjugé

Application: Western Blotting (WB)

Specificité: DGCR8 antibody was raised against the N terminal of DGCR8

Purification: Affinity purified

Immunogène: DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGCR8 Blocking Peptide, catalog no. 33R-2021, is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGCR8

Antigène: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Autre désignation: DGCR8 (DGCR8 Produits)

Synonymes: anticorps MGC78846, anticorps DGCR8, anticorps gy1, anticorps dgcrk6, anticorps C22orf12, anticorps DGCRK6, anticorps Gy1, anticorps pasha, anticorps D16H22S1742E, anticorps D16H22S788E, anticorps D16Wis2, anticorps N41, anticorps Vo59c07, anticorps si:ch211-106a19.4, anticorps wu:fc23f08, anticorps wu:fc38f06, anticorps DGCR8 microprocessor complex subunit L homeolog, anticorps DiGeorge syndrome critical region gene 8, anticorps DGCR8 microprocessor complex subunit, anticorps DGCR8, microprocessor complex subunit, anticorps microRNA 3618, anticorps dgcr8.L, anticorps DGCR8, anticorps dgcr8, anticorps Dgcr8, anticorps MIR3618

Sujet: DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways