RBMS2 anticorps (N-Term)

N° du produit ABIN633313

Cet anticorps Lapin Polyclonal détecte spécifiquement RBMS2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RBMS2 anticorps (N-Term) (ABIN633313)

Antigène: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBMS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBMS2 anticorps

Épitope: N-Term

Specificité: RBMS2 antibody was raised against the N terminal of RBMS2

Purification: Affinity purified

Immunogène: RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBMS2 Blocking Peptide, (ABIN5615802), is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBMS2

Antigène: RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2 (RBMS2))

Autre désignation: RBMS2

Sujet: RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

Poids moléculaire: 44 kDa (MW of target protein)