MOV10L1 anticorps

N° du produit ABIN633316

Cet anticorps Lapin Polyclonal détecte spécifiquement MOV10L1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MOV10L1 anticorps (ABIN633316)

Antigène: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOV10L1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MOV10L1 anticorps

Purification: Affinity purified

Immunogène: MOV10 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOV10L1 Blocking Peptide, (ABIN5614818), is also available for use as a blocking control in assays to test for specificity of this MOV10L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOV10L1

Antigène: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Autre désignation: MOV10L1

Sujet: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 135 kDa (MW of target protein)