Nucleolar Protein 6 anticorps
-
- Antigène Voir toutes Nucleolar Protein 6 (NOL6) Anticorps
- Nucleolar Protein 6 (NOL6)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Nucleolar Protein 6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
- Top Product
- Discover our top product NOL6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOL6 Blocking Peptide, catalog no. 33R-8759, is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Nucleolar Protein 6 (NOL6)
- Autre désignation
- NOL6 (NOL6 Produits)
- Synonymes
- anticorps NRAP, anticorps UTP22, anticorps bA311H10.1, anticorps nrap, anticorps utp22, anticorps AA410091, anticorps Nrap, anticorps nucleolar protein 6, anticorps nucleolar protein 6 L homeolog, anticorps nucleolar protein family 6 (RNA-associated), anticorps NOL6, anticorps Nol6, anticorps nol6.L
- Sujet
- NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis.
- Poids moléculaire
- 127 kDa (MW of target protein)
-