EXOSC7 anticorps (N-Term)
-
- Antigène Voir toutes EXOSC7 Anticorps
- EXOSC7 (Exosome Component 7 (EXOSC7))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOSC7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXOSC7 antibody was raised against the N terminal of EXOSC7
- Purification
- Affinity purified
- Immunogène
- EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC
- Top Product
- Discover our top product EXOSC7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOSC7 Blocking Peptide, catalog no. 33R-2780, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOSC7 (Exosome Component 7 (EXOSC7))
- Autre désignation
- EXOSC7 (EXOSC7 Produits)
- Synonymes
- anticorps EXOSC7, anticorps zgc:110717, anticorps EAP1, anticorps RRP42, anticorps Rrp42p, anticorps hRrp42p, anticorps p8, anticorps 2610002K22Rik, anticorps AV212732, anticorps mKIAA0116, anticorps exosome component 7, anticorps exosome component 7 S homeolog, anticorps exosc7, anticorps EXOSC7, anticorps exosc7.S, anticorps Exosc7
- Sujet
- EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Poids moléculaire
- 32 kDa (MW of target protein)
-