DHX37 anticorps

N° du produit ABIN633324

Cet anticorps anti-DHX37 est un anticorps Lapin Polyclonal détectant DHX37 dans WB. Adapté pour Humain.

Aperçu rapide pour DHX37 anticorps (ABIN633324)

Antigène: DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX37 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHX37 anticorps

Purification: Affinity purified

Immunogène: DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX37 Blocking Peptide, (ABIN5613198), is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX37

Antigène: DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))

Autre désignation: DHX37

Sujet: DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 129 kDa (MW of target protein)