PSMA1 anticorps

N° du produit ABIN633331

Cet anticorps Lapin Polyclonal détecte spécifiquement PSMA1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour PSMA1 anticorps (ABIN633331)

Antigène: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PSMA1 anticorps

Purification: Affinity purified

Immunogène: PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA1 Blocking Peptide, (ABIN5615618), is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA1

Antigène: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Autre désignation: PSMA1

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA