HDLBP anticorps

N° du produit ABIN633334

Détail du produit anti-HDLBP anticorps

Antigène: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HDLBP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HDLBP Blocking Peptide, catalog no. 33R-6516, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HDLBP

Antigène: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Autre désignation: HDLBP (HDLBP Produits)

Synonymes: anticorps HBP, anticorps PRO2900, anticorps VGL, anticorps 1110005P14Rik, anticorps AA960365, anticorps AI118566, anticorps D1Ertd101e, anticorps HDLBP, anticorps vigilin, anticorps cb591, anticorps cb811, anticorps hdlbp, anticorps wu:fb36d01, anticorps wu:fb94h08, anticorps wu:fc23d06, anticorps wu:fc75h07, anticorps high density lipoprotein binding protein, anticorps high density lipoprotein (HDL) binding protein, anticorps vigilin, anticorps high density lipoprotein binding protein (vigilin) S homeolog, anticorps high density lipoprotein binding protein a, anticorps HDLBP, anticorps Hdlbp, anticorps hdlbp.S, anticorps hdlbpa

Sujet: HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Poids moléculaire: 141 kDa (MW of target protein)