THOC1 anticorps (C-Term)

N° du produit ABIN633337

Cet anticorps Lapin Polyclonal détecte spécifiquement THOC1 dans WB et IHC. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour THOC1 anticorps (C-Term) (ABIN633337)

Antigène: THOC1 (THO Complex 1 (THOC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THOC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-THOC1 anticorps

Épitope: C-Term

Specificité: THOC1 antibody was raised against the C terminal of THOC1

Purification: Affinity purified

Immunogène: THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THOC1 Blocking Peptide, (ABIN5616588), is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THOC1

Antigène: THOC1 (THO Complex 1 (THOC1))

Autre désignation: THOC1

Sujet: THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.

Poids moléculaire: 76 kDa (MW of target protein)