THOC1 anticorps (C-Term)
-
- Antigène Voir toutes THOC1 Anticorps
- THOC1 (THO Complex 1 (THOC1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp THOC1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- THOC1 antibody was raised against the C terminal of THOC1
- Purification
- Affinity purified
- Immunogène
- THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
- Top Product
- Discover our top product THOC1 Anticorps primaire
-
anti-THO Complex 1 (THOC1) antibody
THOC1 Reactivité: Humain, Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (C-Term) antibodyKO Validated THOC1 Reactivité: Humain WB, IF, IP, IHC (p), ICC, ChIP Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (AA 428-657) antibodyTHOC1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (C-Term) antibodyTHOC1 Reactivité: Humain, Souris, Rat, Lapin, Chien, Cheval, Cobaye, Boeuf (Vache), Poisson zèbre (Danio rerio), Saccharomyces cerevisiae WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (AA 428-657) antibodyTHOC1 Reactivité: Humain WB, ELISA, IHC, ChIP Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (AA 154-240) antibodyTHOC1 Reactivité: Humain WB, IF, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (AA 511-560) antibodyTHOC1 Reactivité: Humain, Souris, Rat, Lapin, Chien, Cheval, Cobaye, Boeuf (Vache), Singe, Poulet WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) (AA 257-285), (N-Term) antibodyTHOC1 Reactivité: Humain WB Hôte: Souris Monoclonal 301CT40-5-1 unconjugated
anti-THO Complex 1 (THOC1) (C-Term) antibodyTHOC1 Reactivité: Humain, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-THO Complex 1 (THOC1) antibodyTHOC1 Reactivité: Humain WB Hôte: Lapin Monoclonal unconjugated
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
THOC1 Blocking Peptide, catalog no. 33R-9212, is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- THOC1 (THO Complex 1 (THOC1))
- Autre désignation
- THOC1 (THOC1 Produits)
- Synonymes
- anticorps p84, anticorps MGC114861, anticorps Tho1, anticorps THOC1, anticorps Hpr1, anticorps HPR1, anticorps P84, anticorps P84N5, anticorps 3110002N20Rik, anticorps AW107452, anticorps NMP-84, anticorps LRRGT00070, anticorps THO complex 1, anticorps THO complex 1 protein L homeolog, anticorps THO complex subunit 1, anticorps THO complex 1 protein, anticorps thoc1, anticorps thoc1.L, anticorps THOC1, anticorps LOC100123388, anticorps Thoc1
- Sujet
- THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.
- Poids moléculaire
- 76 kDa (MW of target protein)
-
